PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA03G08330.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family B3
Protein Properties Length: 1071aa    MW: 121126 Da    PI: 9.4179
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA03G08330.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B331.62.8e-10100810653595
                       EEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
               B3   35 tltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95  
                        ++l+d+  r W v +    k+  + +t+GWk F+ an+L++gD++ F  +  +e el ++
  ONIVA03G08330.1 1008 VVILKDPMRRLWPVFY--HDKPVFVGFTAGWKPFAAANNLQAGDVCKFVKEM-DEDELAFQ 1065
                       689*************..9***9*************************9443.44444444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086310.489376469IPR003340B3 DNA binding domain
SuperFamilySSF1019361.96E-16378471IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.0E-14379469IPR015300DNA-binding pseudobarrel domain
SMARTSM010196.0E-4379469IPR003340B3 DNA binding domain
CDDcd100173.87E-7391466No hitNo description
SMARTSM010190.039811070IPR003340B3 DNA binding domain
SuperFamilySSF1019362.75E-129991070IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.3E-1110021070IPR015300DNA-binding pseudobarrel domain
CDDcd100172.54E-1310061070No hitNo description
PfamPF023621.9E-710071067IPR003340B3 DNA binding domain
PROSITE profilePS5086310.27810091071IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1071 aa     Download sequence    Send to blast
MDGAVRGQGC VGRLRSFNKT KKKNRNCSDD MRNGDDEEKK YSHHDMKKNL RNDANEEKRK  60
SSDDMRDGDF EEKKKCSRHD MKKNLRNDAN EEKRKSSDDM RDGDDEEKKK CSRQDMKKNL  120
RNDADEEKRK SSDDMRDGDD EEKKKRSRHD MKKNSRNDAD EEKRKRKRKC SDDLKKSVVN  180
DASKEATSHS DWRKNRKAGS DAEQRGKKLL NGDKKAKSRK VTTPFFEKMR KIKMQRTSNQ  240
NGEKNMKSDS DSYKKTVPLS VNKGKMEKDG TNKRTLSNTL VAKERKMRPS DSMEMKMKKK  300
KRDASFVQPD ERTAQTFSTK NKEKKRKAPS TPLKREQKER VASSDNKKET KKACIVAIGN  360
EKKNCRDGKK KKRKAAFAFF KFVRDEFEEL LFIPPAVAPS LKDLIDRHVY LEDSEGKCSK  420
IRLSVVDGSL AFYEGWNSFV SEHCIKWGEF LLFEYTPEST FSVRVFGIDS CERLHFSVKS  480
GGKGAVKKRK ERHTLSDDLI SHYNGQYQDS EDIHDGPNVS GESPRSKEPK ITVDAEIGTR  540
NLVAKSINAA SETQDSERVE SGIGYGSLGA LGNKVRNLSN GECDTRSDSV FCIQEKTRRS  600
EVIIISDEAY STQVDEDTMK QTAPSEASEI HHVAINTQKD LERVVDGVCC ESSVALNNKM  660
GNLILGEPKN KNISPACSTE KTNGSEITPT TGAIPLTQEN IDTVKLNTLS CFEEDRSTTR  720
ESELAAAIPT TSETHDSDKD LGQKHQRISV QVNSIIAVDK YPNDSEMNIS GNIFRIYEAP  780
AGTRCLEKWK RGIVNGRAAL DDIGQVRPEK TQKAGEKLVG NCGAMGESPV DLRIESDVTD  840
TCLKPILNIP IEELSILDSV SISKCGRSRT EVNHLFNQKG ATVQLQTKKE PLKPTGSSGN  900
RKGDKIAVSV NRVFAHQSEL QIPQQENGNF TSCVTPVALL PAKAELLDLD DHSLQFCIPS  960
TIQKWLVFSY SVVQWMQFVE FMLIAVRAEL PKSLPITCRQ KGRYDRNVVI LKDPMRRLWP  1020
VFYHDKPVFV GFTAGWKPFA AANNLQAGDV CKFVKEMDED ELAFQVYITR K
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1143165KKRSRHDMKKNSRNDADEEKRKR
2162168KRKRKRK
3163168RKRKRK
4368373KKKKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1219900.0AK121990.1 Oryza sativa Japonica Group cDNA clone:J033109I02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624189.10.0PREDICTED: B3 domain-containing protein Os02g0598200
RefseqXP_015624190.10.0PREDICTED: B3 domain-containing protein Os02g0598200
SwissprotQ6K5K20.0Y2982_ORYSJ; B3 domain-containing protein Os02g0598200
TrEMBLA0A0E0GIN60.0A0A0E0GIN6_ORYNI; Uncharacterized protein
STRINGLOC_Os02g38470.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122722730
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18960.12e-11B3 family protein